SPD Home Page
SPD Home Page


IPI_IPI00011658
Data Source Information
Sequence>IPI_IPI00011658 (204 aa)
MSLMVVSMACVGFFLLQGAWPHEGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHL
SREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSV
TGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQ
EPAGNRTVNSEDSDEQDHQEVSYA
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDQ14950 KIR2DS2(Nkat5-delta-Ig1 (1060P11.9.2) (Killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2 (Isoform 2)).)

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.