SPD Home Page
SPD Home Page


Hs9_32006_28_3_1
Data Source Information
Sequence>Hs9_32006_28_3_1 (313 aa)
MGRLQLVVLGLTCCWAVASAAKRREDIANSSPERQGAAQGKLGDPMLHYVGFVPVIDGDF
IPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVTEEDFYKLVSEFTITK
GLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYA
YLFSHPSRMPVYPKWVGADHRDEIQTVSKAMTAYWTNFAKTGDPNMGDSAVPTHWEPYTT
ENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEASSMPSTGDSEATPVSP
DRQLRVCPRPCNG
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDQ14018 CELP(Carboxyl ester lipase-like protein.)

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.