SPD Home Page
SPD Home Page


gi_14761798_ref_XP_028103.1_
Data Source Information
Sequence>gi_14761798_ref_XP_028103.1_ (230 aa)
MSMSPTVIILACLGFFLDQSVWAHVGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIY
HLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPV
SVTDAAVMNQEPAGHRTVNREDSDEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDT
SVCIELPNAEPRALSPAHEHHSQALMGSSRETTALSQTQLASSNVPAAGI
Descriptionleukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 5 [Homo sapiens]
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.