SPD Home Page
SPD Home Page


gi_13651609_ref_XP_015913.1_
Data Source Information
Sequence>gi_13651609_ref_XP_015913.1_ (184 aa)
MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWVRVAPGIPILGPHWLPGTGERNTAALFL
AVRR
Descriptiongrowth hormone 2, isoform 2 precursor [Homo sapiens]
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.