SPD Home Page
SPD Home Page


gi_13651553_ref_XP_015899.1_
Data Source Information
Sequence>gi_13651553_ref_XP_015899.1_ (202 aa)
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFNPQ
TSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSN
VYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKD
MDKVETFLRIVQCRSVEGSCGF
Descriptiongrowth hormone 1, isoform 2 precursor [Homo sapiens]
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.