SPD Home Page
SPD Home Page


SOMA_SAIBB
Data Source Information
ACP58343
DescriptionSomatotropin precursor (Growth hormone).
Length217
Sequence>SOMA_SAIBB (217 aa)
MATGSRTSLLLAFTLLCLPQLKEAGAFPTIPLSRLLDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPASKKETQQKSNLELLRISLILIQSWFEPVQLLR
SVFANSLLYGVSDSDVYEYLKDLEEGIQTLMERLEDGSPRTGAIFRQTYSKFDINSQNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDnm_022561

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.