SPD Home Page
SPD Home Page


SOMA_PANTR
Data Source Information
ACP58756
DescriptionSomatotropin precursor (Growth hormone) (GH) (GH-N) (Pituitary growth hormone) (Growth hormone 1).
Length217
Sequence>SOMA_PANTR (217 aa)
MAPGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDnm_022559
SOMA_HUMAN
nm_022560
nm_022561
O14643 GH2(Placental growth hormone 20kDa isoform precursor.)
SOM2_HUMAN
O14644 GH2(Placental growth hormone isoform hGH-V3 precursor.)

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.