SPD Home Page
SPD Home Page


SOMA_NYCPY
Data Source Information
ACQ9GMB2
DescriptionSomatotropin precursor (Growth hormone).
Length217
Sequence>SOMA_NYCPY (217 aa)
MATGSHTATLLLAVALLGLPWPQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFER
AYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQLLS
RVFTNSLVLGTSDRVYEKLKDLEEGIQALMRELEDGSPRVGQILKQTYDKFDTNLRSDDA
LLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDSOMA_MOUSE
Q9R2C3 (Growth hormome.)
SOMA_RAT Gnrhr(Somatotropin precursor (Growth hormone).)

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.