SPD Home Page
SPD Home Page


SOMA_MACMU
Data Source Information
ACP33093
DescriptionSomatotropin precursor (Growth hormone) (GH) (GH-N) (Pituitary growth hormone) (Growth hormone 1).
Length217
Sequence>SOMA_MACMU (217 aa)
MAAGSRTSLLLAFALLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGTSYSDVYDLLKDLEEGIQTLMGRLEDGSSRTGQIFKQTYSKFDTNSHNND
ALLKNYGLLYCFRKDMDKIETFLRIVQCRSVEGSCGF
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDSOMA_HUMAN
nm_022559
nm_022561
nm_022560
SOM2_HUMAN
O14643 GH2(Placental growth hormone 20kDa isoform precursor.)
O14644 GH2(Placental growth hormone isoform hGH-V3 precursor.)

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.