SPD Home Page
SPD Home Page


SOMA_LEPOS
Data Source Information
ACP79885
DescriptionSomatotropin precursor (Growth hormone).
Length211
Sequence>SOMA_LEPOS (211 aa)
MASGFLLCPVLLAVFFMSPVEVGAFPLYSLFTNAVIRAQHLHQLAADIYKDFERTYVPEE
QRQSSKSSPSAICYSESIPAPTGKDEAQQRSDVELLRFSLALIQSWISPLQTLSRVFSNS
LVFGTSDRIFEKLQDLERGIVTLTREIDEGSPRIAAFLTLTYEKFDTNLRNDDALMKNYG
LLACFKKDMHKVETYLKVMKCRRFVESNCTL
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.