SPD Home Page
SPD Home Page


SOMA_LAMPA
Data Source Information
ACP37885
DescriptionSomatotropin (Growth hormone).
Length190
Sequence>SOMA_LAMPA (190 aa)
FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERTYIPEGQRYSIQNAQAAFCFSETIPAP
TGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQ
ALMRELEDGSPRAGQILRQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC
RRFVESSCAF
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDSOMA_MOUSE
SOMA_RAT Gnrhr(Somatotropin precursor (Growth hormone).)
Q9R2C3 (Growth hormome.)

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.