SPD Home Page
SPD Home Page


SOMA_CANFA
Data Source Information
ACP33711
DescriptionSomatotropin precursor (Growth hormone).
Length216
Sequence>SOMA_CANFA (216 aa)
MAASPRNSVLLAFALLCLPWPQEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERA
YIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSR
VFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDAL
LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDSOMA_RAT Gnrhr(Somatotropin precursor (Growth hormone).)
SOMA_MOUSE

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.