SPD Home Page
SPD Home Page


SOM2_PANTR
Data Source Information
ACP58757
DescriptionGrowth hormone variant precursor (GH-V) (Placenta-specific growth hormone) (Growth hormone 2).
Length217
Sequence>SOM2_PANTR (217 aa)
MAAGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLYQLAYDTYQEFEEA
YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDSOM2_HUMAN
O14643 GH2(Placental growth hormone 20kDa isoform precursor.)
O14644 GH2(Placental growth hormone isoform hGH-V3 precursor.)
nm_022560
nm_022561
nm_022559
SOMA_HUMAN

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.