SPD Home Page
SPD Home Page


SOM1_ACIGU
Data Source Information
ACP26773
DescriptionSomatotropin I (Growth hormone I).
Length190
Sequence>SOM1_ACIGU (190 aa)
YPMIPLSSLFTNAVLRAQYLHQLAADIYKDFERTYMPNEQRHSSKNSPSAFCYSETIPAP
TGKDEAQQRSDVELLQFSLALIQSWISPLQSLSRVFTNSLVFLTSDRVFEKLKDLEEGIV
ALMRDLGEGGFGSSTLLKLTYDKFDVNLRNDDALFKNYGLLSCFKKDMHKVETYLKVMKC
RRFVESNCTL
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.