SPD Home Page
SPD Home Page


PSPA_PIG
Data Source Information
ACP49874
DescriptionPulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP).
Length249
Sequence>PSPA_PIG (249 aa)
MLRWPLALTFLLLAVSGLECDVKEVCLASPGIPGTPGSHGLPGRDGRDGIKGDPGPPGPM
GPPGGMAGPPGQDGMIGAPGLPGERGEKGEPGERGPPGLPAHLDEELQSALHEIRHQILQ
SMGVLSFQEFMLAVGEKVFSTNGQSVAFWMSLESCVPEQVGRIAAPRSPEENEAIASIVK
KHNTYAYLGLVEGPTAGDFFYLDGTPVNYTNWYPGEPRGRGKEKCVEMYTDGQWNDRNCQ
QYRLAICEF
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.