SPD Home Page
SPD Home Page


IPI_IPI00072258
Data Source Information
Sequence>IPI_IPI00072258 (377 aa)
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHCRRGFNIF
TLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVT
GLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQA
DFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARH
LHAVIRYSVAIILFTILPFFLLHRWCSKKKNAAVMNQEPAGHRTVNREDSDEQDPQEVTY
AQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETT
ALSQTQLASSNVPAAGI
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDQ8N740 (1060P11.4.2 (Killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 (Isoform 2) (KIR103-AS)).)
Q86U48 (1060P11.4.4 (Killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 (Isoform 4)).)

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.