SPD Home Page
SPD Home Page


IPI_IPI00043172
Data Source Information
Sequence>IPI_IPI00043172 (221 aa)
MRLRFWLLIWLLLGFISHQPTPVSFLKTIFWSRNGHDGSMDVQQRAWRSNXSRQKGLRSI
CMHTKKRVSSFRGNKIGLKDVITLRRHVETKVRXKIRKRKVTTKINRHDKINGKRKTARK
QKMFQRAQELRRRAEDYHKCKIPPSARKPLCNWVSLFVFLAFEHSLPGQDMDTFFSLQLC
AQALQREMAERKAAYRHHSPIPVGNRVVQKHLHPHPVGPLI
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDO75200 (Hypothetical protein.)
ENSP00000329066

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.