SPD Home Page
SPD Home Page


IPI_IPI00032469
Data Source Information
Sequence>IPI_IPI00032469 (325 aa)
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIF
TLYKKDGVPVPELYNRIFWNSFLISPLTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVT
GLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQA
DFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTDAAVMNQEPAGHRTVNREDSDE
QDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQAL
MGSSRETTALSQTQLASSHVPAAGI
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDQ8N736 (1060P11.4.1 (Killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 (Isoform 1)).)

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.