SPD Home Page
SPD Home Page


IPI_IPI00002506
Data Source Information
Sequence>IPI_IPI00002506 (324 aa)
MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIW
DSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVA
FKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGL
NDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKL
FTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMG
KDLLFIRLRYLTGAWRLEQTRKMN
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDQ9HC03 (Dolichyl-phosphate beta-glucosyltransferase.)
Q9CTE8 Alg5(18-day embryo whole body cDNA, RIKEN full-length enriched library, clone:1110019I05 product:DOLICHYL-PHOSPHATE BETA-GLUCOSYLTRANSFERASE (HSPC149) (SIMILAR TO ALG5, S. CEREVISIAE, HOMOLOG OF) homolog (Fragment).)

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.