SPD Home Page
SPD Home Page


INT5_SHEEP
Data Source Information
ACQ28595
DescriptionInterferon tau-5 precursor (IFN-tau5) (Trophoblast protein-1) (Trophoblastin) (Antiluteolysin) (Trophoblast antiluteolytic protein) (P5).
Length195
Sequence>INT5_SHEEP (195 aa)
MAFVLSLLMALVLVSYGPGGSLGCYLSQRLMLDAKENLKLLDRMNRLSPHSCLQDRKDFG
LPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTTLLEQLCTGLQQQLDHLD
TCRDQVMGEKDSELGNVDPIVTVKKYFQGIHDYLQEKGYSDCAWEIVRVEMMRALTVSTT
LQKRLTKMGGDLNSP
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.