SPD Home Page
SPD Home Page


INT2_BOVIN
Data Source Information
ACP56830
DescriptionInterferon tau-2 (IFN-tau2) (Trophoblast protein-1) (TP-1) (Trophoblastin) (Antiluteolysin) (Trophoblast antiluteolytic protein).
Length172
Sequence>INT2_BOVIN (172 aa)
CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEM
LQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGQVMEEKDSDMGRMGPILTV
KKYFQGIHVYLKEKEYSDCAWEIIRMEMMRALSSSTTLQKRLRKMGGDLNSL
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.