SPD Home Page
SPD Home Page


INO2_HORSE
Data Source Information
ACP05002
DescriptionInterferon omega-2 precursor (Interferon alpha-II-2).
Length195
Sequence>INO2_HORSE (195 aa)
MALLPSLLTALVVYELWPCGALGCDLPQNHILVSRKNFVLLGQMSRISSAICLKDRKDFR
FPQDMADGRQFPEAQAASVLHEMLQQIFSLFHTERSSAAWNTTLLDELCTGLLRQLEDLD
TCLEQEMGEEESALGTVRPTLAVKRYFRGIHLYLKEKKYSDCAWEIVRMEIMRSFSSSAN
LQGRLRMKDGDLGSP
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.