SPD Home Page
SPD Home Page


INO1_BOVIN
Data Source Information
ACP07352
DescriptionInterferon omega-1 precursor (Interferon alpha-II-1) (IFN-omega-c1).
Length195
Sequence>INO1_BOVIN (195 aa)
MAFVLSLLMALVLVSYGPGGSLGCDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFA
FPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLD
ACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMRSLSSSTS
LQERLRMMDGDLKSP
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.