SPD Home Page
SPD Home Page


INB_HORSE
Data Source Information
ACP05012
DescriptionInterferon beta precursor (IFN-beta).
Length186
Sequence>INB_HORSE (186 aa)
MTYRWILPMALLLCFSTTALSVNYDLLRSQLRSSNSACLMLLRQLNGAPQRCPEDTMNFQ
VPEEIEQAQQFQKEDAALVIYEMLQHTWRIFRRNFASTGWNETIVKNLLVEVHLQMDRLE
TNLEEIMEEESSTWGNTTILRLKKYYGRISQYLKAKKYSHCAWTVVQAEMLRNLAFLNGL
TDYLQN
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.