SPD Home Page
SPD Home Page


INB1_BOVIN
Data Source Information
ACP01578
DescriptionInterferon beta-1 precursor.
Length186
Sequence>INB1_BOVIN (186 aa)
MTYRCLLQMVLLLCFSTTALSRSYSLLRFQQRQSLKECQKLLGQLPSTSQHCLEARMDFQ
MPEEMKQEQQFQKEDAILVMYEVLQHIFGILTRDFSSTGWSETIIEDLLKELYWQMNRLQ
PIQKEIMQKQNSTTEDTIVPHLGKYYFNLMQYLESKEYDRCAWTVVQVQILTNVSFLMRL
TGYVRD
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.