SPD Home Page
SPD Home Page


INAB_BOVIN
Data Source Information
ACP05008
DescriptionInterferon alpha-B precursor.
Length189
Sequence>INAB_BOVIN (189 aa)
MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLPNRRVLTLLRQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSATTWDESLLDKLHAALDQQLTDLQ
ACLRQEEGLRGAPLLKEGSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN
LQEKFRRKD
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.