SPD Home Page
SPD Home Page


INA4_HORSE
Data Source Information
ACP05006
DescriptionInterferon alpha-4 precursor.
Length184
Sequence>INA4_HORSE (184 aa)
MALPFSLLMALVVLSCHSSCSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFG
FPQEVFDGNQFRKPQAISAVHETIQQIFHLFSTDGSSAAWDESLLDKLYTGLYQQLTELE
ACLSQEVGVEETPLMNEDSLLAVRRYFQRITLYLQEKKYSPCAWEIVRAEIMRSFSSSTN
LPQS
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.