SPD Home Page
SPD Home Page


INA3_CANFA
Data Source Information
ACO97945
DescriptionInterferon alpha-3 precursor (IFN-alpha-3).
Length187
Sequence>INA3_CANFA (187 aa)
MALPCSFSVALVLLSCHSLCCLACHLPDTHSLRNWRVLTLLGQMRRLSASSCDHYTTDFA
FPKELFDGQRLQEAQALSVVHVMTQKVFHLFCTNTSSAPWNMTLLEELCSGLSEQLDDLD
ACPLQEAGLAETPLMHEDSTLRTYFQRISLYLQDRNHSPCAWEMVRAEIGRSFFSLTILQ
ERVRRRK
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.