SPD Home Page
SPD Home Page


INA1_PIG
Data Source Information
ACP49879
DescriptionInterferon alpha-1 precursor (IFN-alpha-1).
Length189
Sequence>INA1_PIG (189 aa)
MAPTSAFLTALVLLSCNAICSLGCDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFG
SPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFYTGLDQQLRDLE
ACVMQEAGLEGTPLLEEDSIRAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRN
LQDRLRKKE
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.