SPD Home Page
SPD Home Page


Hs7_27224_28_3_5
Data Source Information
Sequence>Hs7_27224_28_3_5 (438 aa)
MGCSSPLLSLLSLLVGNGQATSMVPLPGGRFLMGTNSPDGRDGEGPVWEATVKPYAIDTF
PVTNKDFSVLWDKCYLRYSDEESEIQTSLTDSAQLRRVRGQGCSWRWLVLAQAIEELLGD
PALVPTRRQPVGAQRLLQQRQAFAARTPQAGKSRSNDHFLFQHDDDSPPSKRPKTNKLPQ
PPVPEPANDGQRKVREFNSEKWNNHIADLCKQVEELSDRKYGMFKLEKSCNTLFISIYTM
ELLFIMGVLWTSPGLLVNPAILTRLSLHELVNSTREDLQLDKPASGAEALGSTEAKVLLY
QKFEGHANDLYAEGLPENIPFRSPSWYGIPRLENIIQVGNRIKFLIKSLVKGRCHTREGG
GARHVMEPRRVGGGSWLCEEGVKSSLGGADARKGAQALGLTEAVKVPYSVFESNPEFLYV
EGLPDRISFPSPTWFGIP
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDxm_294194

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.