SPD Home Page
SPD Home Page


Hs16_19764_28_12_1
Data Source Information
Sequence>Hs16_19764_28_12_1 (630 aa)
MLHPETSPGRGHLLAVLLALLGTAWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRS
WVQPPAADMRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASF
VEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVC
AYSPRGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCGECMRAQSGDPGVGV
VASYWAVPEALALSTQGGSCPACWEETLFSESPPPLTRGPQESLSHELPEPWTSQHQHLP
LPLSPWLHGQILPSEVQPAVCARPVPGGGVLRKGGVLAQIKSQKVQDILAFYLGRLETTN
EVIDSDFETRNFWIGTLGHGGCQQMARGPGREHMGAASAGKRGQKGSWQQTPGSEWANLD
YPGPGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNHGFGNCVELQASAAFNWNNQRCKTR
NRYICQFASLAFVIHSARLSFCLRMPNDPEKNTDHDIKRPWPRNRDYCDTRFCTSKGIPV
PDHLVEVPLVLGPSLSTCYQRGQLYTRECCHGHDCCYTRAEEAGCSPKTERYSWQCVNQS
VLCVCYAGDIDQIDHTLMISLVGDDLNGIT
DataSupplemental material
Reference14990746 (Identifying secretomes in people, pufferfish and pigs)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.