SPD Home Page
SPD Home Page


CSH_HUMAN
Data Source Information
ACP01243
DescriptionChorionic somatomammotropin hormone precursor (Choriomammotropin) (Lactogen).
Length217
Sequence>CSH_HUMAN (217 aa)
MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
SourceGo
DataSwissProt/Trembl
ReferenceSecrete protein extracted from GOA assignment
SPD Cross-Reference                          
SPDnm_022640
nm_022641
PLL_HUMAN
Q14407 CSH2(Chorionic somatomammotropin CS-2 (Chorionic somatomammotropin hormone 2).)
nm_022644
nm_022645
Q14406 (Chorionic somatomammotropin CS-5.)
nm_022579

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.