SPD Home Page
SPD Home Page


CL43_BOVIN
Data Source Information
ACP42916
DescriptionCollectin-43 precursor (CL-43) (43 kDa collectin).
Length321
Sequence>CL43_BOVIN (321 aa)
MLPLPLSILLLLTQSQSFLGEEMDVYSEKTLTDPCTLVVCAPPADSLRGHDGRDGKEGPQ
GEKGDPGPPGMPGPAGREGPSGRQGSMGPPGTPGPKGEPGPEGGVGAPGMPGSPGPAGLK
GERGTPGPGGAIGPQGPSGAMGPPGLKGDRGDPGEKGARGETSVLEVDTLRQRMRNLEGE
VQRLQNIVTQYRKAVLFPDGQAVGEKIFKTAGAVKSYSDAEQLCREAKGQLASPRSSAEN
EAVTQLVRAKNKHAYLSMNDISKEGKFTYPTGGSLDYSNWAPGEPNNRAKDEGPENCLEI
YSDGNWNDIECREERLVICEF
SourceVertebrate
DataSwissProt
ReferenceKnown SwissProt vertebrate secreted proteins (human, mouse and rat excluded)
SPD Cross-Reference                          
SPDNo match in SPD with such a cutoff: 0.9

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.