SPD Home Page
SPD Home Page

Q9NWZ1*    Sequence
General Information
SourceTREMBL
Official NameFGFRL1
Cross Reference>AK000530 Q9NWZ1 (759 bp)
attgcccggacacacacatgtgcacagatatgctgtctggacatgcacacacgtgcagat
atgctgtccggatacacacgcacgcacacatgcagatatgctgcctgggcacacacttcc
ggacacacatgcacacacaggtgcagatatgctgcctggacacacgcagactgacgtgct
tttgggagggtgtgccgtgaagcctgcagtacgtgtgccgtgaggctcatagttgatgag
ggactttccctgctccaccgtcactcccccaactctgcccgcctctgtccccgcctcagt
ccccgcctccatccccgcctctgtcccctggccttggcggctatttttgccacctgcctt
gggtgcccaggagtcccctactgctgtgggctggggttgggggcacagcagccccaagcc
tgagaggctggagcccatggctagtggctcatccccactgcattctccccctgacacaga
gaaggggccttggtatttatatttaagaaatgaagataatattaataatgatggaaggaa
gactgggttgcagggactgtggtctctcctggggcccgggacccgcctggtctttcagcc
atgctgatgaccacaccccgtccaggccagacaccaccccccaccccactgtcgtggtgg
ccccagatctctgtaattttatgtagagtttgagctgaagccccgtatatttaatttatt
ttgttaaacatgaaagtgcaaaaaaaaaaaaaaaaaaaa
DescriptionHypothetical protein FLJ20523. (Reference: 1)
Sequence>Q9NWZ1 (123 aa)
MRDFPCSTVTPPTLPASVPASVPASIPASVPWPWRLFLPPALGAQESPTAVGWGWGHSSP
KPERLEPMASGSSPLHSPPDTEKGPWYLYLRNEDNINNDGRKTGLQGLWSLLGPGTRLVF
QPC
SPD Annotation
Rank2:Possible secreted protein matched by either Sig-HMM or Psort
CategoryOnly13
SPD Cross-Reference                          
DatabaseNo match in other related database with such a cutoff: 0.9
Protein Family
SingletonNo similar sequences in SPD as well as nine reference datasets

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.