SPD Home Page
SPD Home Page

Q8IWL2    Sequence
General Information
SourceTREMBL
Cross Reference>AY198391 Q8IWL2 (24037 bp)
gccttaaacataagacccaaaggtatgaaactagtaggaaaaagcataggagaagtgctt
caggatattggtctggatgaagattttatggagagacctcaaaagtactgggaacaaaaa
ccaaaaataagccaatatggttatatcaaactaaaaagcttctgcacagaaaagaaaaca
atcaactgagtgaagagacggcctgcagagtgggagaaatatccacaagctattcatcca
ataagggattaatatcctgaatataaaaggaactcaaacaattccacagcaaaacattca
aataatccaatttaaaaataggcaaatgatctgaacagacacttctcaaaagaagacata
aaaatggccacgtatataaatgacactcaatatctctattcctaagataaatgcaaatga
aaccaaaataaattatctcaccccaggtagactggcttttatcaataagacaaaaaagaa
taaatactggtgcgggtgcagagaaaagggaactcatacactgttggtggaaatggaaag
tactacagccattatggaaagcaaaatgaagctttcttgaaaacctaaaactagaactat
catataatctagcaatcccactactgggtattcaaagaaaaggaacccagtatgttaaag
aggtatctaccctcctatgtttattgcggagctattcataatagccaagatatggaatca
acctaagtgtctatcagtgaatgaatggatttaaaacatgtagtaactaaacacaatgga
atacagttcatccataagaaagaataaaattctgccattcatagcaacatgggtgagcca
ttatgttaagtgaaataaagccaggaaaagaaaattaaacacagcatgttctcactcatt
tgtggatgctaagaaaacttagttaatctcatagaagtaaacatagaacagtaagtaaac
agtagaacagaatatattagaggctgggaagattaaggggaatgagaaatgggaaaggtg
gggcaatgggtacaaaattacagctagataggagaaatgagttgtagccttctttagcgc
tgtagggtgaccatagccaacaaaaaaattatgtatactttcaaatagctaaaagagagg
attttgaatgttatcaacacaaaacagtaagtttttgaggtgatgaatatgctgcttacc
ttgatttcatcattgcacattacatacatgtatcaaaatagtccactgtgcccatatgta
tgtaaaataattgtgtcaaaaataacattttttaaattaaaaagatagtaaagaatatat
taccagaagtaaaaacaaacaaactccaagaaaagactatagttacaattatatccctat
gtgtcaatctgaaaagatggctggcatatgtaagagaaaacactaattgtagaacagtat
atgcagtatgatcttattggtgcaaagtaagagaatgtgtgtgtgtgtgtctgcacgtgt
gtgttcctgagcctatttctttgaagacagttgctgccacctgccagtttcaattcctcc
aaggtgcagaatgggaaaacctctctccctctcctcaaaacctcagtaaagcatgatgta
tttctctggggtttggaaggttcaaaatgttcagggcagaaagaagggtgacaaggctgc
attggcaaaaatgaaaataaaaacaagtaatgtgatttttaaggcaaattggatgctatt
tctaggcaacagaaatatatttacagtgttattctttttaaaaataaaatggcattatta
gagaggcatcaatgtaatatatatgtatgtaaacatacagcacacaatatatgtgtgtgt
atatatatgtatataatgcatacacacatatttgcttagtttactggctgcctcagcaaa
gaaaagcctcaacttccatccccttcatgtggctgagctgtcccttagattctgacatta
taagcgattttgaaatatatccatgattagtaaattaatttgtgcattcccttgtcttca
tgtacaggtagaataagcatgttcctctgactctgggaaggttctagcagaggactgagc
tggaaagaagatttctggtaattctggcaatccatgtaacccctgtcatcctcagctgac
tgaagtatggaatggggatttactctctatacaactcatagagtgctgtgatgatccaaa
gtgacagaaagatccagcagtcacagacagcctcctcctactgctagcacccagggcagc
tggaaaagggggcaggggaagggtcccctgagcactaagagagaggcctcaaatatgcag
agaagcccatgcactgtccttagtgcctgtacatggcctccactctgcacccctttgaaa
cgggagagtcccctgatccccctcacaggatgcatgacaggggtgtggctcacctgtttg
gttgccccactgctcaaacccctagggggagcatgcagatgggcaggttcagaggctggg
gtgagtgctttgggctccagctgttcagtagagtctagggatgggtgcctgtaatcctgg
tgttacaaaactctttcagttttgcatacgcaggtggcttgagtgttaatcagctcaatg
gaccctctgccttatcctaagggcagagggcctgtgtgacagctttctgtatcccaagct
ttcacccagcatcctggaagaatcagatcacatgtgggcttgaaggatgagtgcaagatt
ttattgagtggtggaggtggctctcagtgagatggattggggactggaaagggaaatgga
gtgggaaggtgatcttcccttggaggcgggccatccagtagctggtatcttctccgatcg
cccctgggcaaactcccctcagtgttcagatgttcctcctcttctctctctctctgccac
gtcgttccactgtccatctgcttgtctgctagtctgctggtctgcttctggagcctgggg
ttcaaggtttatatggttgcaggataggggttgtggcagaacaaaaggcaactttttggt
catgaaaacagaaatgtcttttctcatttagggccacaggtcttcaggcttgagggtggg
gtctttgttggggagtcaccctttttttacccagtgtgtcactgtctcctgtcattatca
ttcccctcctctgaagaggcacatctaactgcctttagaatatggacgatgaccagtctt
agctacttcctgctgacagggggagttgttttggggaaaatgtcagtcagattcctccca
gacgtctatctaaaggtccctgacaaaagggagccatcatctgaggctctgattgcctga
tcatcttgagtttgataacctctaagtgagagaggaaaaaaaaagttttataagattaag
taggcatgggttaaaattgtgtattatacaaggaaagaatctagtgccaaagattacaga
aataagaagtaaaatatactaattaccctgaaaacactattgtaccccgtggtatagaac
agaacaaaggtaagaaccacaagcataggcaagactacaaagaggacatacatgaaatgt
taattaacactaaccttttgtgatttttagtttgagtaccctgatctcttcacaatggta
ttttgggtgctcctctaggttgaaagaggtgactctgttggcttcccaggcctttacttg
agtataatgaatccaagagtctattctggtgaccttgaccttcaccaccacaggagtgaa
aagaagtacagtgcaaggtccctcccaaccagggcatattgagagagaaaggtaaggaag
tacctttaccagtactaggtcccctgggttgaatagaggtgggcctggttcgtgggattg
ggccttcaacagttgtttcagttcctgttggaaatggaccaaagaggttatgtgcttaat
taaaacaaaggtttcttggtctagcaagaaatcattcatgagaaaatgtcatccatacat
agtctcaaagagactcaaacccagacttgaaggagtgtttctgatatatagcaggactat
ggaaagaagagtagtccaggggagatgagtctcctgagacagtttcttgaggtgcctttt
gataatatcatttttgtcttttctacctttcctgaggattgtggtctccaaacacaatga
agatggtactgtatgcctagtgcctttgagaccccctgggtgacagctgccttgaacgag
gggccattattgctctggaggtacttagggggtccaaagtgaggaattatctcattgatt
agtactattatcacctcagaggctttctctgtctgacatggaaatgcttctactcagtta
gtgaaggtatctatccacactaggaggtactggatgccccttacctttggcatatgggtg
aaatccatttgccagtcttcccctaggtagccttggagaagacactattaattaagggga
ttgtttttaaggcaggtcttgcaagcattaacaacctgtttaactgtttgtatcaggttt
ttatctgagaacaatctgagccagtcagtaggttttatctgtacctaggtggaaggcctg
gagaaggcttttaagaactttccattggttgccagctggtagatgaagcatgccatccta
agaggtgtcccattctatttccataggagagtattgaggttttatttctctgatgggggc
cctccaagatcagtaaggcttcaagtgggtcagagacctggggcccccttgctgctgcta
gctgctcagtctagctagctgctcataaagcagggtgtgaaatagttactctgaatgata
ttgttgagagcacacctctctcctcaggcacaagtgctcaactggccaaactaattaccc
tcatgagagcacttgaattaggcaaaggaaaaacagttaacatttatactgattctaagt
atgctttcctagttctccacacccatgccactatctggaaagacaggaacttcctcacag
ctaatgggtatcccattaaatgccatcaggaaattaatagactattttgctcagttttcc
tcccacaggaagcggctcagcccctagctgctcagtctgccagcccgtttccctcagcta
tttcatccatccctctttggtggcctttacaatgtattactgccacttcctgtgcgtaag
aatcccctcggttgcttgagtgtttggggaggagaaaggaggagataggtttaatccttt
cttcgcccaatgccctggtcccctctgacaagaccaggcttaggtgcttcactgaagtct
gacagagctgagcttcagattttgaaacattatatcctctgttagcaagaaaattaagag
gagccttactgcccttctgagagatttcctcagttggagtgcaaaagagaaggtcctcca
tgtattgcaaaactttgacctgaggataaaggaacttggagagatctctccataatgcct
gcccaaacaagtgggagctgtcttggaatccctgaggtaacattgtccaggttaacaggg
tggtttggttagagggatcctcaaattcaaacaaatactgggagttgtggtataatggta
tgcagaagaaggcatcctttaggtccaggaaccatttagttccctcaggtatttgagcta
gcagggtatacggattgggaatcattgaatgtattggaaccacagcctcattaacaagga
ggtggttctgaactagcctccatttctagttgggtttttgtacccccaatattggggtat
tacaagggctattgcagggtttgagtgggccctccatcttcaagttatcaatgatggctt
ctagtcctttcctaacctctagtttcaggggatattgtttctggttaggaaaggaggtgg
gatccttaagatggacccagactggtatggtagttgtggctctgacaatcttccctagag
ttgcccaaacttctgggttaatattggtctctactaggatgagacaaagagtttccctag
gggccatcagaatgatggtccccacatgggccggaatatccctacccaacagaggagttg
ggctttcaggcataattagaaaagctttggtgaacaaccccaggtacaactaaggggttg
gaaaaaatatcgggttaaagaccttcctgagatgtccctcacagtcatgctaagagagga
gagggggcctggattcaagaggagaactgagagaccagtcccagtgtccaaaaggaggtc
cactttcctctcttcgatttccatgattacccagggcaccttgatgataatggtggtctg
gactacaggagccaggagaggagccctgggacctgtcagtcctgctgctggaccatttgg
aagactggctctggacctggtgaccagcatgcccaggaacagtccaccctccagtggtcc
ccactgcagattggacagggttgaggtagcttcctcatgctgtctgagaaattcttgaaa
tgccctgatttgccacatctgtagcaattgacaggtgcaccctgggaattctggggtttg
tgggcttgtctgctggccattaaagtctctgtctctttcctgtatttcctctctctcttg
tgcctacctatctctattataaaaaaccaaggtgggtactttcagaaggttctctaaagt
actctcttgtcccagagcctgttttgtagcttcctcctgatatcaggggctgcctgagta
gtaaatttatgctttaggattggttgtccctcagctgaatcaggggatagacaggtgtgc
tttactaaggcctcccttggcctttccaggaaggcagtgggattttcatcaaatccctgg
tcaatcatggatgatttagtataattgagaggcttggtcctggtcttacataagccctcc
attatgcacacctgaaagtgcctcctcttccaggcttccatcttgtcattggaatcctat
ttagggtaatccattgatactgcttctctcccagttggataatgtttgcccccttccctg
acactatatgtgatactaagctcatccccaaatctctctgctgcttgcagagcaggctgc
ttctcagtgtctgtcaaggtctggttcaaaagcaacataatgtctctccaggagagatca
aatatttgggtgaaattctggaaagcctctatatatctgtcggggtcatctgaaaagttc
ccaagatcccccttaattcactttaagtcctgtagggaggaggggaactggaccttactg
ggcccaaattcaccaggcattggttgaaggggcaagagtgaggttggggcttgtctaggg
tgaggatttttaggagggggcaagtgagaggctgaagctgaatagggaggtcgaggtaga
cccagaggggaagagctggagggggctggcttctctgcttggggtgcctctgggattcat
atctttagtttcctaggcttgccccttgcagtcctccctgagatggcaaacaggagggct
gtatcaatcctacactgtcagcaaaggtctggattgccttgcaaggtatagaaaacctgc
acatatgggacctcagaccatttgtcttcatgtatacagaaaaggcctgatcaccggata
ctatcgaaatgaaaggttcattcctgaggtccacccggtccttcataatttggccaaacc
tttgtgcagagggctatgaggcatttttcttccagattaagaggatcaaagcagtcccat
tggttctggatacactccagaggggtataagctgggagtggtgaagagagatggttgcct
attctgaaagacagagaatagaggcatgcctcattcccttccttctttagtgaaaactca
gggtgtgatggagagagaaagcaagactgtggactctgaggtggcttggcatgggcgccc
aaggactggcagtgtgaagaggatatccctgcagagggaagaagcccaacgtggagggtg
aggccccgaggagaacgagaaagatactgaaggagagcggactggaccggcgggggcagt
ggagcctaagcagggggaggaggctgtggacacagctgagtggcctggtgtgggcactcg
gaactcagcaggaactacagcaattcttagagctaagagtgacaaatttgtgttgggaga
accatcttcttagcgacattctttagattcactggtgccatgtgctggcaaactgtaact
gtttcaacatcaaacacacgtagtgccccctgcagcccgcaggtgggtgctcggcacccc
ctggtggtcagtggtaggcctcacgaacgagtccacattgctacaaatcaatcaatgggc
aacagagacagtgtgatgaggaatgggatctttacaatagccccaaagtgtgtcctcata
acatagtcactgattaaaaccagaaaaagaatgtatttatggtagtgaagcgtgacaccc
accaccttaattcaatgatcaacaagaacatcatcaatcttggggcaaactaaagtcaca
tgccgcccggtagaatgggagaagagcgcagcaggatgtctatcgcatttctgctgaagt
tacagaacctgaatctaatcatgagccaatacattaaaaaaaaaaaaaaaaaagtgaggg
gcattctacacagtaactctcctgtgatcttcacactgtgttcaggtcatgaaggtgaag
ggaagacagagggcctttgtgggtttcaggaccctggagaagcgtgacaaccgaatacgg
cacatggctcagaaatggatcctttgctataaaggacactattggggcattgggtacatt
ttgcatagggcctgaaggctatttggagttattatatccatgttaatttcttgattatgg
ttataatgcgaaaatgcctttgcatgaaaaacacattaaagtattggggtgttggggttt
catgctgacaacctactttcataggttcagggaaacatatttgtaccgtgcctgcaattc
ttctgtaaatttgatgtttcaagataataaaaacaaaaaggaaactgagcctcaaaatgt
tacataacctgactgagtccacatgggtaataagtgacagctctgggtgaaaactcaggt
gtgcctttcccctaaagtcacgccctgccctgccaaccacaaggccctgcacatctgagt
tggcctctgttcctgctcatcacctgcaaaacagccctgcctccccacagccaagttgct
ggagctgcgccccacctgcccccaccctgcactggcctgactcccccattccacacctgg
cccagcacccaccacatggtgtggcagacagcactggggcagctgaaagactccatgcta
caaattggcactgcccagcttcctgcttctgggagtggggtccattggctgagcttccgc
tccctggaagagctccagactcctcaatggtttgggatttttcaaaccaattccaaataa
gccaggggagattttcctgtcttggttcccatcattaccacctccacagttggagattcc
ctcctaatccagatgctcgaaccaggacctcaacaactagggcttcatatatcactggga
cacttagcataatcaccattgcaggttgccagacatcacccaaagtgatgttctaccaaa
gacagaaactgcagctctcccgtgaccttccaggtgctgccctgactcctccagctgaac
ctgctagggcagagggaagtggaacgtgcagcatatttgccggccactctgcccatgtgc
ccaccaactcagctgcaggctccagggacacaggctggtgggggggcctggggctcatgg
ctgagccaggtcgcaggacagacaagttggcctggatcaacctgaccaatctcagctgga
gcagtgagttcttcattgtctgaatctaaaccaggaacccagtggggcttccttagtgcc
tgtgtaagggctctcggctttcactgctaaggagcttgctaggggcagggtgggtgacct
cagccaagggggggatttctcttcttacagacctggagttcctctttcgcaggttctgtg
ctcccctcaagggtcctttgagatcctccagcctgagtgctcttggggaaacatgctgtg
taaacactatgcccatttcctgcctggagcacaggttttgtggtagggctctcaggggtg
aggaggaagcctggcagcccccacatctataaatgctgcgtctaccttaccctctgactt
ggaggcagagacccaagcagctggaggctctgtgtgtgggtgagtttagccccatcccct
aggtgttctccagcttgaggatcgcaggcagagaggaccagcccagcagccacaggcctg
accaaagcccaggctgggaaggagggcaactccccattttccactgggaggtgtttcaca
gcacagtcaacataggtgacctgcaaagatcctcatgtttgttattttctttggccagat
ccatccctacagggttcagcagggcctacaggaggggcagtgagagaacagaccccaaaa
agaaaggggactccatgactgaccaccttgaggggggccaggctgcgggccccgttcatc
ttttttcattctcaggtcgctgatttcttggagcctgaaaagaaagtaacacagcaggga
tgaggacagatggtgtgagtcagtgagtgagtgacctgactaatagcctgggagggacag
ggcaggttttctgcagagcacggaagattcagctgaagtcagagaggtgaagccagtttc
ccagggtaacatagtgaggcactgaaagaaaggagactgcactggagcccaggtccccgg
gctccccagagctccttactcttcctcctcctcagcagcctggagaccccacaacctcca
gccggaggcctgaagcatgaggccatgccaggtgccaggtgatgctgggaattttcccgg
gagcttcgggtcttcccagcactctggtctcgcccgccctgcctctcgggctctgcccag
cttcctgagtcctgacagagcacagtgggggagatgttggcagaggtggcagatgggctc
acggccatccctcctgcaggagcagcgactggacccagagccatgtggctgtgccctctg
gccctcaacctcatcttgatggcagcctctggtgctgtgtgcgaagtgaaggacgtttgt
gttggaagccctggtatccccggcactcctggatcccacggcctgccaggcagggacggg
agagatggtgtcaaaggagaccctggccctccaggtactgtgctgcagaccccaccctca
gctgagggacacagaccccttttcaggaggcccatctgtccaggcccctaggctgtgggc
catagtgagctgggggctatagtaagctgggtgggacttcagtctgcagggctggtgggt
tcctggggcccttatgatggcgcatcctggagagtctgtcctcatagtgcccacggagtg
atagagtgatagctgagccagccctggtgataatgggcatcgagtctcactagctccaac
cagttgtgggtgacagatcctacacatccatgtctcttttctctgcaggccccatgggtc
cacctggagaaatgccatgtcctcctggaaatgatgggctgcctggagcccctggtatcc
ctggagagtgtggagagaagggggagcctggcgagaggggccctccaggtgagcagggtg
gggcaggtgggcagtggaaacatgggcacagcgaccctgaagtcagttacacggggatga
tggggatcagacaaaccctacaggttccccaagggcatttggctcaacctaagtaagaga
ggataagcttgagggagaaagctgaggtgtctggggagtgtggtcacaattcagggaaag
gcaggtgtgggaagtcctccgtgcctcatgaccaccgatggggacacactgagtcaggtg
tgggatgagggacagcactgggaggcaggggaggcatgtcctgggatggaggccctgggg
gctgtctgaagggtgaatgcggacgaggcatccagacagacggtgtgatcaggagcccca
cagacagaggggagctttgaagctcagagcggtaagcaagtccatcagggcagtgcagag
agcatcatgcttgcccttggtggagggtgcgggagagggacttgccccacagaggcgggc
agacagagcccctcgagggacagagcagaaaataggacaaggggtgggggtctcagcagg
ggcaaggcttcactaaagaataggggaccacggggtgtggagacacactggaatcttgtg
gaccctctgagcctagggtctgggtggcgcctaacagcaatgaaagggcagagttccagg
attgcagatggcaaaacacctgcgtggcagcaagtgggagtcttcactggcctgcccctc
cttctgtgtggggcactctccacagggcttccagctcatctagatgaggagctccaagcc
acactccacgactttagacatcaaatcctgcagacaaggggaggtaaggggaccccctgg
gcctcacggggtaggagtttcccacaaattcccctcattctcagcaccagcttctagaac
atagagattacaaataggcatgcacatgcaggtcttggggaaaggaatgacgcttgcttt
tctgatgtctttgaatggcccacaggagacagaagcagacacaattcactccccatttca
taggaaagcaagttctccacctgccttgctttccactgaattccaggaaattgcaccatt
tctggcaataagtaattgttacttaggtgaatgaataaatggaggagagtctaaaagtga
atttagaaaactgcaattggaagaggaagagaagacacagagagaggcagagatggagag
actggggagaatctggtagcagagaccccaggtgagggaggtggcttagagacaaagtgg
tcagtggcctgacccggactcctctgctctcagccctcagtctgcagggctccataatga
cagtaggagagaaggtcttctccagcaatgggcagtccatcacttttgatgccattcagg
aggcatgtgccagagcaggcggccgcattgctgtcccaaggaatccagaggaaaatgagg
ccattgcaagcttcgtgaagaagtacaacacatatgcctatgtaggcctgactgagggtc
ccagccctggagacttccgctactcagacgggacccctgtaaactacaccaactggtacc
gaggggagcccgcaggtcggggaaaagagcagtgtgtggagatgtacacagatgggcagt
ggaatgacaggaactgcctgtactcccgactgaccatctgtgagttctgagaggcattta
ggccatgggacagggaggacgctctctggccttcggcctccatcctgaggctccacttgg
tctgtgagatgctagaactccctttcaacagaattcacttgtggctattgggactggagg
cacccttagccacttcattcctctgatgggccctgactcttccccataatcactgaccag
ccttgacactccccttgcaaactctcccagcactgcaccccaggcagccactcttagcct
tggccttcgacatgagatggagccctccttattccccatctggtccagttccttcactta
cagatggcagcagtgaggtcttggggtagaaggaccctccaaagtcacacaaagtgcctg
cctcctggtcccctcagctctgcctctgcagcccactgcctgcccagtgccatcaggatg
agcaatcctggccaagcataatgacagagagaggcagacttcggggaagccctgactgtg
cagagctaaggacacagtggagattctctggcactctgaggtctctgtggcaggcctggt
caggctctccatgaggttagaaggccaggtagtgttccagcagggtggtggccaagccaa
ccccatgattgatgtgtacgattcactcctttgagtctttgaatggcaactcagccccct
gacctgaagacagccagcctaggcctctagggtgacctagagccgccttcagatgtgacc
cgagtaactttcaactgatgaacaaatctgcaccctacttcagatttcagtgggcattca
catcaccccccacaccactggctctgctttctcctttcattaatccattcacccagatat
ttcattaaaattatcacgtgccaggtcttaggatatgtcgtggggtgggcaaggtaatca
gtgacagttgaagatttttttttcccagagcttatgtcttcatctgtgaaatgggaataa
gatacttgttgctgtcacagttattaccatccccccagctaccaaaattactaccagaac
tgttactatacacagaggctattgactgagcacctatcatttgccaagaaccttgacaag
cacttctaatacagcatattatgtactattcaatctttacacaatgtcacgggaccagta
ttgtttcctcattttttataaggacactgaagcttggaggagttaaatgttttgagtatt
attccagagagcaagtggcagaggctggatccaaacccatcttcctggacctgaagctta
tgcttccagccaccccactcctgagctgaataaagatgatttaagcttaataaatcgtga
atgtgttcacatgagtttccatagctttggttccaagaaatatcacatttctgtattttt
gtaaatcaaatgaactctgactctgagcccccacttgcctgaagattggaaaattcaatc
tcaggatgtgctttctttgtttggtaggaggagccacctcctctcctcactatgatgctg
cagagggatggggagctacagccaccatttggaagaacatacgggcttcctgagtccaca
tggtccatttgtgggtgggaataccatgtcttctgtcccctactcagccacctgaatgat
ttctgcagcccagcagtgatggtggcactcagggctcagtcccaggccttagtgagccat
cctagtctcaggtctgcatggaatgggaccacactctcatgacccagggctgcgcaggaa
tgagacaatgtctccaattgcttgaggaggcagctacatatgtgtcccacctcccacttc
tccccctataacacctgtgaacactctttctcagtgcatttattgcttttcttgggcgga
aggaagctcagaaaaccaatgagaataagaggaaatttttctcagtcttttatgagtgat
aatttttaatctgatcaccattccatatgtgcttaggacccagcacagaaattattgagc
cttcttcaaaattaagaaaaaaagcaagtagaagcatgtacagatgtatctcgacttatg
atggggtgacatcccaataatcacattgcaggatgagaatatattaagtggaaaatgcat
ttaatacacctaacctaccaaacatcatagctgagcctggagtaacttaaacatgcccag
aaaacttatgttagcctgcagttgggcaaaatcatctaacacaaggctgattttataatg
aggtgttgactgtctcatgaaatttatggaatgctggactgaaactgaatgaataattca
gttatatgtgtacttgaagtatggcttctactggatttgcattgcttttaagtcattgca
aagtggaaaaattgtaagtcggacagttgtaaatccaggacagtctacattcccaattat
atagataaatactttaagcctctgaaaatttgcatctattgagataatcatgtggttttt
gtctttagttctgtttatgtgatgaatcacttttattgatttgcgtatgtggaaccaagc
ttgcatcctagggatgaagtttacttgattgtggtggataagctttttgatgtgtcactt
gattcggtttgccagtattttgttaaggatttttgcatcaatgttcatcaagaatattgg
cctgaagttttcttttttgttgtatctgccaggttttggtatcaaaatgatgctagcctt
acagaatgagttaaggaggagttgcttcttttcaattttttggaatagttttagtaggaa
tggtaccaactcttctttgtacctctggtagaattaagctgtgactccatctggtcctgg
gatttttttggtgggcaggctatttattactgcctcaacttcagaactcattatttgtct
attcagggattccatttcttcctgattctttcttgggagggcgtatatgtccagggcata
tttatccatttcttctagattttctagtttatgtgcacagaggtgtttatagtattctct
gatggttgtttgtatttcgtggggtcagtggtgatatcccccttatcatttctgattgtg
tctatttgaatcttctcttttcttctttattagtctagctagtgatctatctattttatt
aattttttcaaaaatccacctccaggatttgttgatatttttaaggtttttcgtgtctct
gtgtccttcgattctgctctgatcttggttatttcttttcttctgctagctttggggttt
atttgctcttagttctctagttcttttagttgtgatattaggttattaactttctaactt
tttgatatgggcatttagtgctataaatttccctcttaacattgctttagctgtgtccca
gggattctggcatgttgtgtctttgttctcattagtttcaaagaagttcttgatgtttgc
cttaatttcattgtttacccaagagtcatacaagagcaggtttttcaatttctatgtagt
tgtgtggttttgagtgaacttcttcatctcgagttctaatttgattgcattattgtctga
gagactgtttgttattatgtcagttctttttcatttgttgagtgttttacttccaattat
gtgatcaattttagagtaagtaggatgtgtcaatgagaagaatgtatattctgttgtttt
ggggtggagagttctgtagacatctaacaggtccacttgatccagagttgagttcagatc
ctgaataactttgttaattttctgtctcaattatctatctaatattgtcaatggggtgtt
aaagtctcccactattatgtgtgggagtctaagtctctttgaatgtctccaagaacttgc
tttatgaatctgagtgctcctgtattgggcacatatatgtttagaagagttatctcttct
tgttgaattgaactctttaccactatgtaaggctcttctttgtctttttttatctttgta
ggtttaaagtctgttttgtcagaaactaggattgcagcccctgcttttttctgtttttca
tttgcttggtaaattttcctccatccctttattttgagcctatgtgtgtctttgcatatg
aaatgggtctctttaagacaacatactgatgggtcttaattctttatccagcttgccatt
ctgtgtcttttaattagggtcatttactccatttacatttaagaatagtattgatatgtg
tggatttgatcctgtcatgatgatgccagctgcttattttgcagacttgtttatgtggtt
gcttcagtgtcactgctctgtgtactttggtgtgtttttgtagtggctggtaacagtttt
cctttccatatttagtgtttccttcaggagctcttgcaaagcagacctggtcatgatgaa
ttcactcagcattttcttgtctgaaaaggattttatttctccttcgcttatgaagcttag
tttggccagatatgaaattctgggttggaaattctttttttaaaggaagttgactgttgg
cccccaatcttttctaacctgtggtgtttccactaagagattcacagttagtctgatgga
cttcccttggtaggtgacctggcctttgtctcaggctgcccttaacattttttctttcat
tatgaccttggagaatctgattattttatcttggaaatgatcttctcatggagtatctta
ctggggttctctgcatttccttaatttgaatattagcttgtcttgcttggttggggagtt
tctcctggatgatatcctgaagtatgttttccaacttggttccattttccccatcacttt
cagataccccaatcagtgatagattcagtctctttacataattccatatttcttgtaggt
tttgttcatttcttttcattcttttgtctctatttttgtctgcctgtcttaattcagaaa
gcaagttttccagttctgagattctttcctccacttggtctactctgctattaatacttg
taattgcactgtgaagttcttgcagtctgtttttcagctctaacaggttggttatgttcc
tctcaaaactggctgctttggctgtcagtttccatatgattttatcaagattcttagctt
ctttgcattggattgcaacatgctcctttagctctgtgaagtttgttattacccaccttt
tgaggcctacttctgtcattcagacatctcagcctcagcccagttctgagcccttgctgg
gaggtgttgcagtcatttggagaaaaaggggcactctggctttttgagttttcagcattt
ttgcattgattctttctaatctttgttggcttacctacctttgatctttaaggttactga
cctttggatggggtttttgttgtttttctttgttgttgttgttgttgttttccgtctatt
tgtatttcttttaacagtcttcccacccttccatagggctgctgtggtttgctgggaggc
tgctccagaccctagttgcctcagttcttcccatacctggaggtatcaccagtgaaggtg
gtcccagggagagatcagagctctgtccgtaatatgtgccagtgggaatggctggaaagc
ctggctgggaggtcccactaagtgaggagaaatggatcaggtccctgctaaaagaagcag
tctggccaccatctgtcaaagcaactacattgtgcttctgcggggattctttcttgtctg
gactgtgtggactttccaaagcccatagactgaaagggctgagtcaaccctcctccctgg
ggctccattctgtctcaggcaggctccatcctgttactgatggcaacctggaattccaag
ccagtgggtattatctcgcgaggtaccatggaagtggagcccatggaatgaggctgctca
ggctccctggattttacccccttcctaggggtatgtgtggacctcccacctttgtacctc
tgagttgcagacacagtttttggggatcccggggctagggcatataaaactcctaagtct
ctgtgtgtgcatgagtagctgctctgccaagactgcacacagctctgtgtgtcagacctg
gcatgggctcatgaggggatctcctgatcagtgggttacaaagctctgtgggagaacagt
ggtttcctggggtaatacaatcacacaccccttcccttggctgggggtgggggttccctt
agctctgtgtcactcctgggtgggccattgtccaatcctgctttccttcattgtctgtgg
gtcaagttatttccctgaacagtcccaatgtgactatctggatatttcaatttcaggtgc
tgtgttcactcgcccctttcattcctctttgtgagtgccgcgaactacagctgcttctaa
tcggccatcttctcatttctttttagatttatttttacttactttgtggtttaattttct
gttgttactatactattttatattctaaattaattattgctagtttgtaagaaaaatttt
tgatatatattatttgttgatcttataccctaccatctttttggaacctcgttttccccc
aatatttctaatataactgattttgttatattttatatgtttctatttacaaacagtaga
aattttgtatatctctttttgcaatttatatatatatatatttttaattttattattatt
atactttaagttttagggtacatgtgcacaacgtgcaggtttgttacatatgtatacata
tgccatgttggtgtgctgcacccattaactcatcatttagcattaggtatatctcctaat
gctatccctcccccctccccccaccccacaacaggccccggtgtgtgatgttccccttcc
tgtgtccatgtgttctcattgttcaattcccacctatgagtgagaacatgcggtgtttgg
ttttttgtccttgcgataatttgctgagcatgatgattccagtttcatccatgtccctgc
aaaggacatgaattcatcattttttatggctgcatagtattccatggtgtgtatgtgcca
cattttcttaatccagtctatcgttgttggacatttaggttggttccaagtctttgctat
tgtgaatagtgccgcaataaacatacatgtgcatgtgtctttatagcagcatgatttata
atcctttgggtatatacccattaatgggatggctgggtcaaatggtatttctagttctag
atccctgaggaatcgccacactgacttccacaatggttgaactagtttacagtcccacca
acagtgtaaaagtgttcctatttctccacatcctctccagcacctgttgtttcctgactt
tttaatgatcgccattctaactggtgtgagatggtatctcattgtggttttgatttgcat
ttctctgatggccagtgatgatgagcattttttcatgtgttttttgcctgcataaatgtc
ttcttttgagaagtgtctgttcatatccttcgcccactttttgatggggttgtttggttt
tttcttgtaaatttgtttaagttctttgtagattctggatattagccctttatcagatga
gtaggttgcaaaaattttctcccattctgtaggttgcctgttcactctgatggtagtttc
ttttgctgtgcagaagctcttgagtttaattagatcccatttgtcaattttggcttttgt
tgccattgcttttggtgttttagacatgaagtccttgcccatgctgtaaatgggctaaat
gctccaattaaaagacacagactggcaaattggataaagagtcaagacccatcagtgtgc
tgtattcagtaaacccatctcacctgcagggacacacataggctcaaaataaagggatgg
aggaagatctaccaagcaaatggaaagccatttatatttttatatcccctttttataggg
gccgggagaacctatacatttttgaagagactcattgaaatttttcattgagtctttgtg
acataagtttatgtctagaaaaccccataatcctggcccaaaagcttcttcagctgacaa
acaacttcagcaaagtttcaagatacaaaatcaacataaaaaatccctagcattcctata
tacgccaacaaaagacaagccaaaagcgaaatcagggatgcgatcccattcacaattgcc
tcaaaaagaataaaatacccagcaatacagctaaccagggaagtgaaagatctccacaat
gagaattacaaaacactgctcaaataaatcacaaacaaatgagaaaacatcccatgctca
tggtagaaagaatcaataccattaaaatagccatactgcccaaagcgttttacagattca
atggtattcatatcaaactccaatgacattcttcacagaactgtaaaacactattttaaa
attcatatggtaccaaaagacaataaagctggaggcatcacgttacccaaacctcaacct
gtaccacagggctgcagtaaccaaaacagcatggtactaatacaaaaatagacccataga
ccaagggaatggaacagagatcccagaaataaggctgcactactacaaccatctgatttt
caacaacgctaaaacaaaaacaaaccagcaatgaggaaaggacttcctattcaataaatg
gtgctggaataactggccagtcatatgcagaagattgaaactggaccccttttttatacc
atatacaaaaatcagctcaagatggattaaaggcttaaatgtaaaacccaaaactatgaa
aaccctggaagacaacctaggcaataccattctggacatcggaacaggcaaagatttcat
gacaaacacaccaaaagcaatcataatgaaagcaaaaactgacaaaaggggatcaaatta
aacttaagagcttctgcacagcaaaagaaactatcaacagagtaaacaaacaacatacag
tatgggagaaaatgtttgcaagctatgcatgtgacaaaggtctaatatccagcatctata
aaaactgaagcaaatttacaagaaaaaaattaaaaactggacaaagaacatgaacagaca
cttttcaaaagaagacatacacgcagccaacaagcttaagaaaaaaatctcaatttcacc
aattattaaaaaatacaaatcaaaaccacaatgagataacatctcacaccagtcagaata
gctattattaaaaggtcaaaaaataacaaatgctgatgaggttgcagagaaaaggaaatg
tttatacactgttggttagagtgcaaattagttcaaccattgtgaaaaataatgtggcag
ttcctgcggccaaaaaacatagaaaaaaagctcatcatcactggtcatcagagaaatgca
aatcaaaaccataatggtataccatctcacaccagttagaatggtgatcattaaaaagtc
aggaaacaacagatgctggagaggatgtggagaaataggaacacttttacactgttggtg
ggagtgtaaattagttcaaccattgtggaagacagtgtggtgattcctcaaggatttaga
accagaaatgccatttgacccagcaatcgcattactgggtacatactaaaatgtacataa
atcattctactataaagacacatgcacacatatgtttattgcagcactgttcacaatagc
aaagacttggaagcaacccaaatacccatcaatgatagactggattaaaaaaatgtggca
catatgcaccatggaatactatgcagccataaaaaaggataagttcctgtcctttgcagg
gacatggatgaagcttgaaaccatcattctcagcaaactaacacaagaacagaaaaccaa
acaatgcatgttctcactcataagtgggagttgaacaatgagaacacatggacaaaggga
ggggaacattacacaccagggcctgtcagggggtgagggctatgggagggacagcatcag
gagaaatacctaatgtagatgatgagttgatgggtgcagcaaacaaccttggcccgtgta
tacctatgtaacaaacctgcacattctgcacatgtatcccagaacttaaagtataattta
gaaatatatgcaaaaaacaaataatttgctgaggaaatttttatctatgtgcatcatagg
atttttgcattatgagtgagactgacctgtgatattccttttttgtatgttccttgtcac
atttttgtattgagatcattttggtctcaaaaaataaaaaatttttaaatttttttctat
tttcttgaggattttgtatgagattagaacaatttcttaaattatttgtaaaattcactg
aggaagacataattatagattgaatttataaatctatgtagaaaactatttagatttttg
tacatcttcttgtgtaagttttggaatttatatttttcaatgagtttatccatttcctat
actttttcaaatttattggcataaagtaatttctattatcattttatgatctttatgtct
gtaggatatgtagtgttagactcctcatcgttcctga
GO00:sugar binding (IEA)
DescriptionSurfactant, pulmonary-associated protein A1. (Reference: 1)
Sequence>Q8IWL2 (248 aa)
MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPM
GPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLY
SRLTICEF
SPD Annotation
Rank2:Possible secreted protein matched by either Sig-HMM or Psort
CategoryOnly12
Homolog ClusterPossible redundancy or paralogs:
PSPA_HUM*nm_00541Q8IWL1nm_00692
SPD Cross-Reference                          
GoPSPA_HUMAN  (Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP) (Alveolar proteinosis protein) (35 kDa pulmonary surfactant- associated protein).)
Protein Family
Family_id: 7551. PSPA_HUMAN Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP) (Alveolar proteinosis protein) (35 kDa pulmonary surfactant- associated protein). ( SFTPA1 0 human ) Spd Go
2. nm_023134 Mus musculus surfactant associated protein A (Sftpa), mRNA. ( Sftpa 1 mouse ) Spd
3. PSPA_RAT Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP). ( Sftpa1 0 rat ) Spd
4. Q8IWL1 Surfactant, pulmonary-associated protein A2. ( N/A 2 human ) Spd
5. Q8IWL2 Surfactant, pulmonary-associated protein A1. ( N/A 2 human ) Spd
6. nm_005411 Homo sapiens surfactant, pulmonary-associated protein A1 (SFTPA1), mRNA. ( SFTPA1 2 human ) Spd
7. nm_006926 Homo sapiens surfactant, pulmonary-associated protein A2 (SFTPA2), mRNA. ( SFTPA2 2 human ) Spd
8. nm_017329 Rattus norvegicus surfactant, pulmonary-associated protein A1 (Sftpa1), mRNA. ( Sftpa1 1 rat ) Spd
9. PSPA_MOUSE Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP). ( N/A 0 mouse ) Spd
10. PSPA_RABIT Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP).  Vertebrate
11. PSPA_PIG Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP).  Vertebrate
12. PSPA_CAVPO Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP).  Vertebrate
13. PSPA_CANFA Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP).  Vertebrate
14. CL43_BOVIN Collectin-43 precursor (CL-43) (43 kDa collectin).  Vertebrate
15. PA5085 C-type lectin-like  Riken
16. 10075578 Pulmonary surfactant-associated protein A precursor (SP-A) (PSP-A) (PSAP) (Alveolar proteinosis protein) (35 kDa pulmonary surfactant- associated protein). ( extracellular space Homo sapiens . ) Subloc
17. gi_13645187_ref_XP_018470.1_ Hpp
18. gi_14743651_ref_XP_005864.2_ Hpp
19. IPI_IPI00012617 Hpp
20. gi_14743668_ref_XP_039059.1_ Hpp
21. gi_16156698_ref_XP_057873.1_ Hpp
22. Hs10_8905_28_26_1 Hpp
23. Hs10_8905_28_24_1 Hpp
24. IPI_IPI00012889 Hpp
25. gi_14743662_ref_XP_039057.1_ Hpp

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.