SPD Home Page
SPD Home Page

Q14018*    Sequence
General Information
SourceTREMBL
Official NameCELP
Cross Reference>L14813 Q14018 (1214 bp)
cacccagaggctgatgctcaccatggggcgcctgcaactggttgtgttgggcctcacctg
ctgctgggcagtggcgagtgccgcgaagaccccatgctgcactatgtgggcttcgtccct
gtcattgatggagacttcatccccgctgacccgatcaacctgtacgccaacgccgccgac
atcgactatatagcaggcaccaacaacatggacggccacatcttcgccagcatcgacatg
cctgccatcaacaagggcaacaagaaagtcacggaggaggacttctacaagctggtcagt
gagttcacaatcaccaaggggctcagaggcgccaagacgacctttgatgtctacaccgag
tcctgggcccaggacccatcccaggagaataagaagaagactgtggtggactttgagacc
gatgtcctcttcctggtgcccaccgagattgccctagcccagcacagagccaatgccaag
agtgccaagacctacgcctacctgttttcccatccctctcggatgcccgtctaccccaaa
tgggtgggggccgaccatagagatgagatccagtacatctttggggagccctttgccacc
ccactccgggctaccggccccaagacaggacagtctctaaggccatgaccgcctactgga
ccaactttgccaaaacaggggaccccaacatgggcgactcggctgtgcccacacactggg
aaccctacactacggaaaacagcggctacctggagatcaccaagaagatgggcagcagct
ccatgaagcggagcctgagaaccaacttcctgcgctactggaccctcacctatctggcgc
tgcccacagtgaccgaccaggaggccagttccatgccctccacaggggactctgaggcca
ctcccatctcccccgacaggcaactccgagtctgcccccgtccctgcaacgggtgactct
caggatgcccctgtgcccctcacaagtgactctgaggctcccccgtaccctacgggtgac
tctgaggcccgtgcccaccttgggtgacactgaggctgcccctgtgtcccccacagatga
ctccgaggaagctcagatgctgcagtcattagtttctagtgtcccatcagccttggtctc
aagaggccgagagggtgcaaccccaggggctcccctcccatcttgagctcttcctgaata
aaacctcattcccc
DescriptionCarboxyl ester lipase-like protein. (Reference: 1)
Sequence>Q14018 (59 aa)
MLTMGRLQLVVLGLTCCWAVASAAKTPCCTMWASSLSLMETSSPLTRSTCTPTPPTSTI
SPD Annotation
Rank1:Possible secreted protein matched by both Sig-HMM and Psort
CategoryOnly14
SPD Cross-Reference                          
Hppgi_14734895_ref_XP_035053.1_  gi_16161030_ref_XP_055158.1_  gi_16161033_ref_XP_055159.1_  
Hs9_25968_28_17_2  Hs9_25968_28_17_3  Hs9_32006_28_1_2  
Hs9_32006_28_3_1  IPI_IPI00018514  IPI_IPI00036884  
IPI_IPI00053179  
Protein Family
Family_id: 76801. Q14018 Carboxyl ester lipase-like protein. ( CELP 1 human ) Spd
2. IPI_IPI00018514 Hpp
3. gi_16161033_ref_XP_055159.1_ Hpp

CopyRight © Center for Bioinformatics, Peking University
Any questions, please do not
hesitate to contact us via this mail adress.